ShopDreamUp AI ArtDreamUp
Deviation Actions
Suggested Deviants
Suggested Collections
You Might Like…
Featured in Groups
2018bigsisterblondeblondehairbluechildcloudsdelfindelfinedelphindelphinedigitaldolphindolphinsfamilygreeneyeshappykidmamamaymerboymerfolkmermaidmermaidsmermanmerpeoplemommothermumnephewocoriginalphotoshopportraitrocksaiseaseagullsseaweedsistersittingskysmallsmilesmilingsonstarfishwaterwaterscapeyoungmermaymermay2018
Description
For Mermay (the month when artists create more mermaid-related art) my big sister and her young son got turned into merpeople, designed after dolphins. The dolphin part was requested by her, the rest - which means the idea of creating this picture at all - is mine
After drawing myself as a mermaid (tabascofanatikerin.deviantart.…) I felt like making my sister and my nephew merpeople, too. So I asked her what kind of fish or other water creature they wanna be. She chose dolphins.
Hopefully she and her son like that one.
It's possible that I will do at least one more about them as merpeople because it was fun. Also I had a more complex idea for a first picture (she playing piano while the boy is playing with his toy trains and tracks) but due to time trouble I chose a more simple motif. I would love to see them underwater for example.
Done with SAI and Adobe Photoshop.
After drawing myself as a mermaid (tabascofanatikerin.deviantart.…) I felt like making my sister and my nephew merpeople, too. So I asked her what kind of fish or other water creature they wanna be. She chose dolphins.
Hopefully she and her son like that one.
It's possible that I will do at least one more about them as merpeople because it was fun. Also I had a more complex idea for a first picture (she playing piano while the boy is playing with his toy trains and tracks) but due to time trouble I chose a more simple motif. I would love to see them underwater for example.
Done with SAI and Adobe Photoshop.
Image size
1000x1281px 484.65 KB
© 2018 - 2024 Tabascofanatikerin
Comments9
Join the community to add your comment. Already a deviant? Log In
I almost thought that was both Morty and Beth from Rick and Morty.